PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00015342-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 329aa    MW: 36379.1 Da    PI: 8.8198
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00015342-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-16131176148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ +++E+el+++ +++lG++ W++Ia +++ gRt++++k++w+++l
  PSME_00015342-RA 131 RGNISPDEEELIIRMHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 176
                       7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173267127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-11111137IPR009057Homeodomain-like
SuperFamilySSF466897.1E-21111186IPR009057Homeodomain-like
PROSITE profilePS500904.193111125IPR017877Myb-like domain
PROSITE profilePS5129426.455126180IPR017930Myb domain
SMARTSM007172.6E-16130178IPR001005SANT/Myb domain
PfamPF002496.3E-15131176IPR001005SANT/Myb domain
CDDcd001675.25E-13135176No hitNo description
Gene3DG3DSA:1.10.10.601.1E-21138176IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
VGLSIPFVIA IQRRLHATLL IHGTTAVDDF IIPWKRLRPV RNGKKRAPAS AQPDYKKLGV  60
DASKGKPAST WGELLVARNK RSSIGGPGLQ RRIPDFPSIF RLMGKVDGGL NRCGKSCRLR  120
WLNYLRPDIK RGNISPDEEE LIIRMHRLLG NRWSLIAGRL PGRTDNEIKN YWNTHLSKKL  180
TMSSQNPKLP MQSLADPEQS TSSDSSEDVV VRSTDHGMNN HSGISSAPAK IGGTNFSARV  240
PAPVASEEVV IMKSWKQLLE DSLMNDYDDS EDNNSLMGIE LSNDILESEA PLMEIQTNVS  300
CSTSEPNESV HSHGHLLADA TSNQSSERD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1811218040108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6765980.0EF676598.1 Picea sitchensis clone WS02743_O08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLG11e-128B8LLG1_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-40myb domain protein 5